PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2DS_3F5D36630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 349aa    MW: 38001.5 Da    PI: 8.3946
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2DS_3F5D36630.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.63.9e-151462148
                           TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                           +g+W++eEd +l++   ++G+g +W + +++ g++R++k+c++rw++yl
  Traes_2DS_3F5D36630.1 14 KGPWSPEEDAKLKEFMDKHGTGgNWIALPQKAGLRRCGKSCRLRWLNYL 62
                           79*********************************************97 PP

2Myb_DNA-binding34.93.6e-1169111246
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            g +T+ Ed  +    +  G++ W+ Ia+ ++ gRt++++k++w++
  Traes_2DS_3F5D36630.1  69 GEFTEHEDRVICSMYASIGSR-WSIIASQLP-GRTDNDIKNYWNT 111
                            78*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.066966IPR017930Myb domain
SuperFamilySSF466891.06E-2611109IPR009057Homeodomain-like
SMARTSM007174.8E-111364IPR001005SANT/Myb domain
PfamPF002492.0E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-231569IPR009057Homeodomain-like
CDDcd001672.49E-81662No hitNo description
PROSITE profilePS5129415.81867117IPR017930Myb domain
SMARTSM007175.8E-1167115IPR001005SANT/Myb domain
PfamPF002493.0E-969111IPR001005SANT/Myb domain
CDDcd001671.03E-770113No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2270117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MGRAPCCDKN NVKKGPWSPE EDAKLKEFMD KHGTGGNWIA LPQKAGLRRC GKSCRLRWLN  60
YLRPNIKHGE FTEHEDRVIC SMYASIGSRW SIIASQLPGR TDNDIKNYWN TKLKKKLLGS  120
TTMAGVGPPP RAPRQNHHQH RPVLLPYSSS PHSNYSNFFP GAGALLQQSA EPLTLQAQDH  180
YMLGSSGSLN HMNNNNNGAS AVQLQLLHAT AAHRQLQVKE ECGSGGAMIA FGCGDQQSCS  240
SSDGTQYAGG QYVHGGRHHG KEMSFDNNNG YSAYGVYGSG AGAVEQEHKL SFQLQHQQEQ  300
QQAQLDYSYE EIKQLLMTAA ASGADGGGGL IHDPELIGAH AATGKLTMM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-27141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3686600.0AK368660.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2077K09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581397.11e-132PREDICTED: transcription factor RAX2-like
TrEMBLW5C4H70.0W5C4H7_WHEAT; Uncharacterized protein
STRINGMLOC_5849.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.16e-71myb domain protein 36
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]